Loading...
Statistics

UniqueBiz
www.smartgo.online/
Uniquebiz is a responsive creative business template
Advertisement

Smartgo.online

Home Conversion Technology Metas Server
Smartgo.online is hosted in China / Hangzhou . Smartgo.online doesn't use HTTPS protocol. Number of used technologies: 6. First technologies: Carousel, CSS, Font Awesome, Number of used javascripts: 15. First javascripts: Jquery.min.js, Bootstrap.min.js, Jquery.easing.min.js, Number of used analytics tools: 0. Number of used plugins, modules: 0. Its server type is: nginx.

Technologies in use by Smartgo.online

Technology

Number of occurences: 6
  • Carousel
  • CSS
  • Font Awesome
  • Google Font API
  • Html
  • Html5

Advertisement

Javascripts

Number of occurences: 15
  • jquery.min.js
  • bootstrap.min.js
  • jquery.easing.min.js
  • smoothscroll.min.js
  • jquery.sticky.js
  • jquery.inview.min.js
  • jquery.countTo.min.js
  • jquery.shuffle.min.js
  • jquery.magnific-popup.min.js
  • jquery.BlackAndWhite.min.js
  • owl.carousel.min.js
  • ajaxchimp.js
  • jquery-jvectormap-2.0.3.min.js
  • jquery-jvectormap-world-mill-en.js
  • scripts.js

Server Type

  • nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Smartgo.online

Missing HTTPS protocol.

    Meta - Smartgo.online

    Number of occurences: 5
    • Name:
      Content: IE=edge
    • Name: viewport
      Content: width=device-width, initial-scale=1
    • Name: description
      Content: Uniquebiz is a responsive creative business template
    • Name: keywords
      Content: onepage, portfolio, corporate, business, parallax, creative, agency
    • Name: author
      Content: trendytheme.net

    Server / Hosting

    • IP: 120.27.47.6
    • Latitude: 30.29
    • Longitude: 120.16
    • Country: China
    • City: Hangzhou

    Rname

    • dns9.hichina.com
    • dns10.hichina.com

    Target

    • hostmaster.hichina.com

    HTTP Header Response

    HTTP/1.1 200 OK Server: nginx Date: Fri, 16 Sep 2016 12:26:05 GMT Content-Type: text/html;charset=UTF-8 Vary: Accept-Encoding Set-Cookie: JSESSIONID=F2DA0A28C8D08EC4FE0781873EEE53F2; Path=/; HttpOnly X-Cache: MISS from s_mf85 X-Cache-Lookup: MISS from s_mf85:80 Transfer-Encoding: chunked Via: 1.1 s_mf85 (squid/3.5.14) Connection: keep-alive

    DNS

    host: smartgo.online
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 120.27.47.6
    host: smartgo.online
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: dns9.hichina.com
    host: smartgo.online
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: dns10.hichina.com
    host: smartgo.online
    1. class: IN
    2. ttl: 600
    3. type: SOA
    4. mname: dns9.hichina.com
    5. rname: hostmaster.hichina.com
    6. serial: 2016031716
    7. refresh: 3600
    8. retry: 1200
    9. expire: 3600
    10. minimum-ttl: 360

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.martgo.online, www.semartgo.online, www.emartgo.online, www.swmartgo.online, www.wmartgo.online, www.sdmartgo.online, www.dmartgo.online, www.sxmartgo.online, www.xmartgo.online, www.sfmartgo.online, www.fmartgo.online, www.sgmartgo.online, www.gmartgo.online, www.stmartgo.online, www.tmartgo.online, www.sartgo.online, www.smpartgo.online, www.spartgo.online, www.smoartgo.online, www.soartgo.online, www.smiartgo.online, www.siartgo.online, www.smkartgo.online, www.skartgo.online, www.sm.artgo.online, www.s.artgo.online, www.smuartgo.online, www.suartgo.online, www.smjartgo.online, www.sjartgo.online, www.smnartgo.online, www.snartgo.online, www.sm-artgo.online, www.s-artgo.online, www.smrtgo.online, www.smaortgo.online, www.smortgo.online, www.smaprtgo.online, www.smprtgo.online, www.sma9rtgo.online, www.sm9rtgo.online, www.smartgo.online, www.smrtgo.online, www.smairtgo.online, www.smirtgo.online, www.smaurtgo.online, www.smurtgo.online, www.smatgo.online, www.smaritgo.online, www.smaitgo.online, www.smarotgo.online, www.smaotgo.online, www.smarltgo.online, www.smaltgo.online, www.smarltgo.online, www.smaltgo.online, www.smar.tgo.online, www.sma.tgo.online, www.smargo.online, www.smartqgo.online, www.smarqgo.online, www.smartago.online, www.smarago.online, www.smart go.online, www.smar go.online, www.smartwgo.online, www.smarwgo.online, www.smartego.online, www.smarego.online, www.smartzgo.online, www.smarzgo.online, www.smartxgo.online, www.smarxgo.online, www.smartcgo.online, www.smarcgo.online, www.smarto.online, www.smartgso.online, www.smartso.online, www.smartgxo.online, www.smartxo.online, www.smartgyo.online, www.smartyo.online, www.smartgho.online, www.smartho.online, www.smartgno.online, www.smartno.online, www.smartgco.online, www.smartco.online, www.smartgdo.online, www.smartdo.online, www.smartgeo.online, www.smarteo.online, www.smartgro.online, www.smartro.online, www.smartgto.online, www.smartto.online, www.smartgbo.online, www.smartbo.online, www.smartgvo.online, www.smartvo.online, www.smartg.online, www.smartgob.online, www.smartgb.online, www.smartgoh.online, www.smartgh.online, www.smartgog.online, www.smartgg.online, www.smartgoj.online, www.smartgj.online, www.smartgom.online, www.smartgm.online, www.smartgo .online, www.smartg .online, www.smartgov.online, www.smartgv.online,

    Other Reviews

    1. Planet Ernie
      United Kingdom - 83.170.69.51
      Server software: Perl Dancer 1.3071
      Technology: Html
      Number of meta tags: 5
    2. kasimpasalikemalefendivakfi.net | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
      Cyprus - 93.89.226.17
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html
    3. 骞夸
      Shenzhen (China) - 203.86.26.175
      Server software: Microsoft-IIS/6.0
      Technology: CSS, Html, Swf Object
      Number of meta tags: 2
    4. home
      Jacksonville (United States) - 209.17.116.7
      Server software: Microsoft-IIS/8.5
      Technology: CSS, Html, Html5
      Number of meta tags: 5
    5. IBS-mage.se – Symptom, lindring och kostråd
      Har du IBS-mage? Beroende på dina symptom finns det olika mat- och kostråd. Även medicin kan lindra symptomen på IBS.
      Stockholm (Sweden) - 109.74.5.217
      Server software: Apache/2.4.10 (Debian)
      Technology: CSS, Google Font API, Html, Html5, Javascript, PageSpeed Module, Php, SVG, Google Analytics, Wordpress, Facebook Box
      Number of Javascript: 8
      Number of meta tags: 5
    6. idoweddingplanner.co.uk
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    7. paynerealty.ca
      Scottsdale (United States) - 184.168.221.51
      Server software: squid/3.5.13
      Technology: Html, Html5, Iframe
    8. valenciapropertyfinder.com
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    9. deathofhonor.net
      Burlington (United States) - 66.96.149.1
      Server software: Apache/2
      Technology: Html
    10. scienceontap.com
      West Chester (United States) - 162.211.82.133
      Server software: Apache
      Technology: CSS, Html5, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 2